MCT3 Antikörper

Produktnummer ABIN630366

Zitiert in 1 Publikation. Der Kaninchen Polyklonal anti-MCT3 Antikörper (ABIN630366) detektiert spezifisch MCT3 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für MCT3 Antikörper (ABIN630366)

Target: MCT3 (Monocarboxylate Transporter 3 (MCT3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MCT3 Antikörper

Aufreinigung: Purified

Immunogen: SLC16 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC16A8 Blocking Peptide, (ABIN5616184), is also available for use as a blocking control in assays to test for specificity of this SLC16A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-MCT3 Antikörper (ABIN630366)

Tian, Xiao, Su, Li, Peng, Meng: "Impact of SLC16A8 on tumor microenvironment and angiogenesis in colorectal cancer: New therapeutic target insights." in: World journal of gastrointestinal oncology, Vol. 17, Issue 4, pp. 99188, (2025) (PubMed).

Details zu MCT3

Target: MCT3 (Monocarboxylate Transporter 3 (MCT3))

Andere Bezeichnung: SLC16A8

Hintergrund: SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Molekulargewicht: 55 kDa (MW of target protein)