MCT3 Antikörper

Produktnummer ABIN630366

Produktdetails anti-MCT3 Antikörper

Target: MCT3 (Monocarboxylate Transporter 3 (MCT3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SLC16 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC16A8 Blocking Peptide, catalog no. 33R-7805, is also available for use as a blocking control in assays to test for specificity of this SLC16A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCT3

Target: MCT3 (Monocarboxylate Transporter 3 (MCT3))

Andere Bezeichnung: SLC16A8 (MCT3 Produkte)

Synonyme: MCT3 antikoerper, REMP antikoerper, Mct3 antikoerper, fb78b01 antikoerper, zgc:56344 antikoerper, wu:fb78b01 antikoerper, wu:fk28b01 antikoerper, SLC16A3 antikoerper, solute carrier family 16 member 8 antikoerper, solute carrier family 16 (monocarboxylic acid transporters), member 8 antikoerper, pdgfa associated protein 1a antikoerper, SLC16A8 antikoerper, Slc16a8 antikoerper, pdap1a antikoerper

Hintergrund: SLC16A8 is proton-linked monocarboxylate transporter. It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.

Molekulargewicht: 55 kDa (MW of target protein)