SGCG Antikörper

Produktnummer ABIN630345

Dieses Anti-SGCG-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SGCG in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für SGCG Antikörper (ABIN630345)

Target: SGCG (Sarcoglycan, gamma (35kDa Dystrophin-Associated Glycoprotein) (SGCG))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SGCG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SGCG Antikörper

Aufreinigung: Purified

Immunogen: SGCG antibody was raised using a synthetic peptide corresponding to a region with amino acids FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SGCG Blocking Peptide, (ABIN938493), is also available for use as a blocking control in assays to test for specificity of this SGCG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGCG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SGCG

Target: SGCG (Sarcoglycan, gamma (35kDa Dystrophin-Associated Glycoprotein) (SGCG))

Andere Bezeichnung: SGCG

Hintergrund: Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).

Molekulargewicht: 32 kDa (MW of target protein)