SLC1A5 Antikörper

Produktnummer ABIN630342

Dieses Anti-SLC1A5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC1A5 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund. Dieses Primary Antibody wurde in 1 Publikation zitiert.

Kurzübersicht für SLC1A5 Antikörper (ABIN630342)

Target: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC1A5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SLC1A5 Antikörper

Aufreinigung: Purified

Immunogen: SLC1 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC1A5 Blocking Peptide, (ABIN938301), is also available for use as a blocking control in assays to test for specificity of this SLC1A5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-SLC1A5 Antikörper (ABIN630342)

Krämer, Gröner, Hoffmann, Craig, Brugger, Drzezga, Timmer, Neumaier, Zlatopolskiy, Endepols, Neumaier: "Evaluation of 3-l- and 3-d-[18F]Fluorophenylalanines as PET Tracers for Tumor Imaging." in: Cancers, Vol. 13, Issue 23, (2021) (PubMed).

Details zu SLC1A5

Target: SLC1A5 (Solute Carrier Family 1 Member 5 (SLC1A5))

Andere Bezeichnung: SLC1A5

Hintergrund: SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport, Warburg Effekt