COX IV Antikörper (N-Term)

Produktnummer ABIN630318

Dieses Anti-COX IV-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von COX IV in WB und IHC. Geeignet für Human.

Kurzübersicht für COX IV Antikörper (N-Term) (ABIN630318)

Target: COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COX IV Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-COX IV Antikörper

Bindungsspezifität: N-Term

Spezifität: COX4 I1 antibody was raised against the N terminal of COX4 1

Aufreinigung: Purified

Immunogen: COX4 I1 antibody was raised using the N terminal of COX4 1 corresponding to a region with amino acids AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 2 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COX4I1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this COX4I1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COX IV

Target: COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))

Andere Bezeichnung: COX4I1

Hintergrund: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.

Molekulargewicht: 19 kDa (MW of target protein)

Pathways: Proton Transport