PTK2B Antikörper (C-Term)

Produktnummer ABIN630279

Dieser Anti-PTK2B Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von PTK2B in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für PTK2B Antikörper (C-Term) (ABIN630279)

Target: PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTK2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PTK2B Antikörper

Bindungsspezifität: C-Term

Spezifität: PTK2 B antibody was raised against the C terminal of PTK2

Aufreinigung: Purified

Immunogen: PTK2 B antibody was raised using the C terminal of PTK2 corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTK2B Blocking Peptide, (ABIN5615657), is also available for use as a blocking control in assays to test for specificity of this PTK2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTK2B

Target: PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))

Andere Bezeichnung: PTK2B

Hintergrund: PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity.

Molekulargewicht: 116 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Cellular Glucan Metabolic Process, Cell-Cell Junction Organization, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Positive Regulation of fat Cell Differentiation, VEGF Signaling