FXYD5 Antikörper (N-Term)

Produktnummer ABIN630255

Dieses Anti-FXYD5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von FXYD5 in WB. Geeignet für Human.

Kurzübersicht für FXYD5 Antikörper (N-Term) (ABIN630255)

Target: FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FXYD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FXYD5 Antikörper

Bindungsspezifität: N-Term

Spezifität: FXYD5 antibody was raised against the N terminal of FXYD5

Aufreinigung: Purified

Immunogen: FXYD5 antibody was raised using the N terminal of FXYD5 corresponding to a region with amino acids LQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDD

Anwendungsinformationen

Applikationshinweise: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FXYD5 Blocking Peptide, (ABIN5613668), is also available for use as a blocking control in assays to test for specificity of this FXYD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXYD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FXYD5

Target: FXYD5 (FXYD Domain Containing Ion Transport Regulator 5 (FXYD5))

Andere Bezeichnung: FXYD5

Hintergrund: FXYD5 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIon Channel (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme.

Molekulargewicht: 20 kDa (MW of target protein)