Annexin A2 Antikörper (C-Term)

Produktnummer ABIN630252

Dieses Anti-Annexin A2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Annexin A2 in WB. Geeignet für Chemical.

Kurzübersicht für Annexin A2 Antikörper (C-Term) (ABIN630252)

Target: Annexin A2 (ANXA2)

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Annexin A2 Antikörper

Bindungsspezifität: C-Term

Spezifität: Annexin A2 antibody was raised against the C terminal of ANXA2

Kreuzreaktivität: Human, Maus, Hund

Aufreinigung: Purified

Immunogen: Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A2 Blocking Peptide, (ABIN5612078), is also available for use as a blocking control in assays to test for specificity of this Annexin A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin A2

Target: Annexin A2 (ANXA2)

Andere Bezeichnung: Annexin A2

Substanzklasse: Chemical

Hintergrund: ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: S100 Proteine