Annexin A2 Antikörper (C-Term)
-
- Target Alle Annexin A2 (ANXA2) Antikörper anzeigen
- Annexin A2 (ANXA2)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Chemical
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Annexin A2 antibody was raised against the C terminal of ANXA2
- Kreuzreaktivität
- Human, Maus, Hund
- Aufreinigung
- Purified
- Immunogen
- Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
- Top Product
- Discover our top product ANXA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Annexin A2 Blocking Peptide, catalog no. 33R-7972, is also available for use as a blocking control in assays to test for specificity of this Annexin A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Annexin A2 (ANXA2)
- Andere Bezeichnung
- Annexin A2 (ANXA2 Produkte)
- Substanzklasse
- Chemical
- Hintergrund
- ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- S100 Proteine
-