Annexin A3 Antikörper (C-Term)

Produktnummer ABIN630251

Produktdetails anti-Annexin A3 Antikörper

Target: Annexin A3 (ANXA3)

Bindungsspezifität: C-Term

Reaktivität: Chemical

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Annexin A3 antibody was raised against the C terminal of ANXA3

Kreuzreaktivität: Human, Hund

Aufreinigung: Purified

Immunogen: Annexin A3 antibody was raised using the C terminal of ANXA3 corresponding to a region with amino acids RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Annexin A3 Blocking Peptide, catalog no. 33R-7970, is also available for use as a blocking control in assays to test for specificity of this Annexin A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Annexin A3

Target: Annexin A3 (ANXA3)

Andere Bezeichnung: Annexin A3 (ANXA3 Produkte)

Substanzklasse: Chemical

Hintergrund: This gene, ANXA3, encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.

Molekulargewicht: 36 kDa (MW of target protein)