IL18RAP Antikörper (N-Term)

Produktnummer ABIN630238

Produktdetails anti-IL18RAP Antikörper

Target: IL18RAP (Interleukin 18 Receptor Accessory Protein (IL18RAP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IL18RAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IL18 RAP antibody was raised against the N terminal of IL18 AP

Aufreinigung: Purified

Immunogen: IL18 RAP antibody was raised using the N terminal of IL18 AP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IL18RAP Blocking Peptide, catalog no. 33R-6858, is also available for use as a blocking control in assays to test for specificity of this IL18RAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 AP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IL18RAP

Target: IL18RAP (Interleukin 18 Receptor Accessory Protein (IL18RAP))

Andere Bezeichnung: IL18RAP (IL18RAP Produkte)

Synonyme: IL18RAP antikoerper, ACPL antikoerper, CD218b antikoerper, CDw218b antikoerper, IL18RB antikoerper, interleukin 18 receptor accessory protein antikoerper, IL18RAP antikoerper, Il18rap antikoerper

Hintergrund: IL18RAP is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.

Molekulargewicht: 66 kDa (MW of target protein)