Complement C2 Antikörper (Middle Region)

Produktnummer ABIN630230

Der Kaninchen Polyklonal Anti-Complement C2-Antikörper wurde für WB validiert. Er ist geeignet, Complement C2 in Proben von Human, Ratte, Maus, Hund und Zebrafisch (Danio rerio) zu detektieren.

Kurzübersicht für Complement C2 Antikörper (Middle Region) (ABIN630230)

Target: Complement C2

Reaktivität: Human, Ratte, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Complement C2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Complement C2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Complement C2 antibody was raised against the middle region of C2

Aufreinigung: Purified

Immunogen: Complement C2 antibody was raised using the middle region of C2 corresponding to a region with amino acids INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Complement C2 Blocking Peptide, (ABIN939465), is also available for use as a blocking control in assays to test for specificity of this Complement C2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Complement C2

Target: Complement C2

Hintergrund: Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.

Molekulargewicht: 83 kDa (MW of target protein)