G3BP1 Antikörper (N-Term)
-
- Target Alle G3BP1 Antikörper anzeigen
- G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser G3BP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- G3 BP antibody was raised against the N terminal Of G3 p
- Aufreinigung
- Purified
- Immunogen
- G3 BP antibody was raised using the N terminal Of G3 p corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE
- Top Product
- Discover our top product G3BP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
G3BP Blocking Peptide, catalog no. 33R-2785, is also available for use as a blocking control in assays to test for specificity of this G3BP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))
- Andere Bezeichnung
- G3BP (G3BP1 Produkte)
- Hintergrund
- G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-