G3BP1 Antikörper (N-Term)

Produktnummer ABIN630227

Der Kaninchen Polyklonal Anti-G3BP1-Antikörper wurde für WB validiert. Er ist geeignet, G3BP1 in Proben von Human, Maus und Hund zu detektieren.

Kurzübersicht für G3BP1 Antikörper (N-Term) (ABIN630227)

Target: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser G3BP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-G3BP1 Antikörper

Bindungsspezifität: N-Term

Spezifität: G3 BP antibody was raised against the N terminal Of G3 p

Aufreinigung: Purified

Immunogen: G3 BP antibody was raised using the N terminal Of G3 p corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

G3BP Blocking Peptide, (ABIN938171), is also available for use as a blocking control in assays to test for specificity of this G3BP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu G3BP1

Target: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Andere Bezeichnung: G3BP

Hintergrund: G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom