Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

GNAS Antikörper (N-Term)

Dieses Anti-GNAS-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GNAS in WB und IHC. Geeignet für Human.
Produktnummer ABIN630225

Kurzübersicht für GNAS Antikörper (N-Term) (ABIN630225)

Target

Alle GNAS Antikörper anzeigen
GNAS (GNAS Complex Locus (GNAS))

Reaktivität

  • 78
  • 29
  • 25
  • 10
  • 8
  • 7
  • 6
  • 5
  • 5
  • 5
  • 4
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Human

Wirt

  • 73
  • 9
  • 1
Kaninchen

Klonalität

  • 75
  • 8
Polyklonal

Konjugat

  • 53
  • 7
  • 6
  • 5
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser GNAS Antikörper ist unkonjugiert

Applikation

  • 65
  • 40
  • 29
  • 16
  • 13
  • 8
  • 8
  • 3
  • 3
  • 2
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (IHC)
  • Bindungsspezifität

    • 10
    • 10
    • 8
    • 7
    • 7
    • 6
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    GNAS antibody was raised against the N terminal of GNAS

    Aufreinigung

    Purified

    Immunogen

    GNAS antibody was raised using the N terminal of GNAS corresponding to a region with amino acids SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
  • Applikationshinweise

    WB: 2.5 µg/mL, IHC: 4-8 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    GNAS Blocking Peptide, (ABIN5613808), is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAS antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    GNAS (GNAS Complex Locus (GNAS))

    Andere Bezeichnung

    GNAS

    Hintergrund

    Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

    Molekulargewicht

    42 kDa (MW of target protein)

    Pathways

    Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Embryonic Body Morphogenesis
Sie sind hier:
Chat with us!