GNAS Antikörper (C-Term)

Produktnummer ABIN630224

Der Kaninchen Polyklonal Anti-GNAS-Antikörper wurde für WB validiert. Er ist geeignet, GNAS in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für GNAS Antikörper (C-Term) (ABIN630224)

Target: GNAS (GNAS Complex Locus (GNAS))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNAS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GNAS Antikörper

Bindungsspezifität: C-Term

Spezifität: GNAS antibody was raised against the C terminal of GNAS

Aufreinigung: Purified

Immunogen: GNAS antibody was raised using the C terminal of GNAS corresponding to a region with amino acids YFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNAS Blocking Peptide, (ABIN936058), is also available for use as a blocking control in assays to test for specificity of this GNAS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNAS

Target: GNAS (GNAS Complex Locus (GNAS))

Andere Bezeichnung: GNAS

Hintergrund: This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Embryonic Body Morphogenesis