GEM Antikörper (C-Term)

Produktnummer ABIN630220

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GEM in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für GEM Antikörper (C-Term) (ABIN630220)

Target: GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GEM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-GEM Antikörper

Bindungsspezifität: C-Term

Spezifität: GEM antibody was raised against the C terminal of GEM

Aufreinigung: Purified

Immunogen: GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GEM Blocking Peptide, (ABIN938459), is also available for use as a blocking control in assays to test for specificity of this GEM antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GEM

Target: GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))

Andere Bezeichnung: GEM

Hintergrund: GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.

Molekulargewicht: 33 kDa (MW of target protein)