DVL1 Antikörper

Produktnummer ABIN630211

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DVL1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DVL1 Antikörper (ABIN630211)

Target: DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DVL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DVL1 Antikörper

Aufreinigung: Purified

Immunogen: DVL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DVL1 Blocking Peptide, (ABIN940474), is also available for use as a blocking control in assays to test for specificity of this DVL1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DVL1

Target: DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))

Andere Bezeichnung: DVL1

Hintergrund: DVL1 is a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 gene is a candidate for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1 gene. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: WNT Signalweg, Synaptic Membrane, Skeletal Muscle Fiber Development