Cullin 5 Antikörper (C-Term)

Produktnummer ABIN630202

Produktdetails anti-Cullin 5 Antikörper

Target: Cullin 5 (CUL5)

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cullin 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Cullin 5 antibody was raised against the C terminal of CUL5

Aufreinigung: Purified

Immunogen: Cullin 5 antibody was raised using the C terminal of CUL5 corresponding to a region with amino acids VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cullin 5 Blocking Peptide, catalog no. 33R-9706, is also available for use as a blocking control in assays to test for specificity of this Cullin 5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cullin 5

Target: Cullin 5 (CUL5)

Andere Bezeichnung: Cullin 5 (CUL5 Produkte)

Synonyme: cul5 antikoerper, wu:fd17d09 antikoerper, wu:fi20h12 antikoerper, xx:11fd17d09 antikoerper, zgc:66185 antikoerper, Xcullin5 antikoerper, CG1401 antikoerper, CUL5 antikoerper, Cul5 antikoerper, Cullin 5 antikoerper, Cullin5 antikoerper, Dmel\\CG1401 antikoerper, cul-5 antikoerper, vacm-1 antikoerper, vacm1 antikoerper, VACM-1 antikoerper, VACM1 antikoerper, 4921514I20Rik antikoerper, 8430423K24Rik antikoerper, AI852817 antikoerper, C030032G03Rik antikoerper, C330021I08Rik antikoerper, Cullin-5 antikoerper, cullin 5a antikoerper, cullin 5 L homeolog antikoerper, Cullin 5 antikoerper, cullin 5 antikoerper, Cullin-5 antikoerper, cul5a antikoerper, cul5.L antikoerper, Cul5 antikoerper, CUL5 antikoerper, cul5 antikoerper, cul-5 antikoerper

Hintergrund: CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development