Cullin 5 Antikörper (C-Term)

Produktnummer ABIN630202

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Cullin 5 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Zebrafisch (Danio rerio) und Hund.

Kurzübersicht für Cullin 5 Antikörper (C-Term) (ABIN630202)

Target: Cullin 5 (CUL5)

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cullin 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cullin 5 Antikörper

Bindungsspezifität: C-Term

Spezifität: Cullin 5 antibody was raised against the C terminal of CUL5

Aufreinigung: Purified

Immunogen: Cullin 5 antibody was raised using the C terminal of CUL5 corresponding to a region with amino acids VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cullin 5 Blocking Peptide, catalog no. 33R-9706, is also available for use as a blocking control in assays to test for specificity of this Cullin 5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cullin 5

Target: Cullin 5 (CUL5)

Andere Bezeichnung: Cullin 5

Hintergrund: CUL5 encodes a protein that is involved in the regulation of cellular growth and promotes vif ubiquination.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development