RRM1 Antikörper (N-Term)

Produktnummer ABIN630191

Der Kaninchen Polyklonal anti-RRM1 Antikörper wird verwendet zum Nachweis von RRM1 in Proben von Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund und C. elegans. Er wurde validiert für WB.

Kurzübersicht für RRM1 Antikörper (N-Term) (ABIN630191)

Target: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RRM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RRM1 Antikörper

Bindungsspezifität: N-Term

Spezifität: RRM1 antibody was raised against the N terminal of RRM1

Aufreinigung: Purified

Immunogen: RRM1 antibody was raised using the N terminal of RRM1 corresponding to a region with amino acids ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRM1 Blocking Peptide, (ABIN936944), is also available for use as a blocking control in assays to test for specificity of this RRM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RRM1

Target: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Andere Bezeichnung: RRM1

Hintergrund: RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity