RRM1 Antikörper (C-Term)

Produktnummer ABIN630171

Dieses Anti-RRM1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RRM1 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für RRM1 Antikörper (C-Term) (ABIN630171)

Target: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RRM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RRM1 Antikörper

Bindungsspezifität: C-Term

Spezifität: RRM1 antibody was raised against the C terminal of RRM1

Aufreinigung: Purified

Immunogen: RRM1 antibody was raised using the C terminal of RRM1 corresponding to a region with amino acids MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RRM1 Blocking Peptide, (ABIN5615962), is also available for use as a blocking control in assays to test for specificity of this RRM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RRM1

Target: RRM1 (Ribonucleotide Reductase M1 (RRM1))

Andere Bezeichnung: RRM1

Hintergrund: RRM1 is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. Its gene is located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. Its gene may play a role in malignancies and disease that involve this region.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity