RSAD2 Antikörper (C-Term)

Produktnummer ABIN630161

Produktdetails anti-RSAD2 Antikörper

Target: RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RSAD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: RSAD2 antibody was raised against the C terminal of RSAD2

Aufreinigung: Purified

Immunogen: RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RSAD2 Blocking Peptide, catalog no. 33R-10171, is also available for use as a blocking control in assays to test for specificity of this RSAD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSAD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RSAD2

Target: RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))

Andere Bezeichnung: RSAD2 (RSAD2 Produkte)

Hintergrund: RSAD2 is a potential antiviral effector.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response