PSG1 Antikörper (N-Term)

Produktnummer ABIN630159

Dieser Anti-PSG1-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von PSG1 in WB und IHC. Geeignet für Human.

Kurzübersicht für PSG1 Antikörper (N-Term) (ABIN630159)

Target: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PSG1 Antikörper

Bindungsspezifität: N-Term

Spezifität: PSG1 antibody was raised against the N terminal of PSG1

Aufreinigung: Purified

Immunogen: PSG1 antibody was raised using the N terminal of PSG1 corresponding to a region with amino acids SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSG1 Blocking Peptide, (ABIN5615612), is also available for use as a blocking control in assays to test for specificity of this PSG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSG1

Target: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Andere Bezeichnung: PSG1

Hintergrund: PSG1 plays an immunomodulatory roles during pregnancy.

Molekulargewicht: 47 kDa (MW of target protein)