Renin Antikörper (C-Term)

Produktnummer ABIN630157

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Renin in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für Renin Antikörper (C-Term) (ABIN630157)

Target: Renin (REN)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Renin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Renin Antikörper

Bindungsspezifität: C-Term

Spezifität: Renin antibody was raised against the C terminal of REN

Aufreinigung: Purified

Immunogen: Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Renin Blocking Peptide, (ABIN936227), is also available for use as a blocking control in assays to test for specificity of this Renin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Renin

Target: Renin (REN)

Andere Bezeichnung: Renin

Hintergrund: Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour