Olfactomedin 4 Antikörper (C-Term)

Produktnummer ABIN630153

Dieses Anti-Olfactomedin 4-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Olfactomedin 4 in WB. Geeignet für Human.

Kurzübersicht für Olfactomedin 4 Antikörper (C-Term) (ABIN630153)

Target: Olfactomedin 4 (OLFM4)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Olfactomedin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Olfactomedin 4 Antikörper

Bindungsspezifität: C-Term

Spezifität: OLFM4 antibody was raised against the C terminal of OLFM4

Aufreinigung: Purified

Immunogen: OLFM4 antibody was raised using the C terminal of OLFM4 corresponding to a region with amino acids EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OLFM4 Blocking Peptide, (ABIN937748), is also available for use as a blocking control in assays to test for specificity of this OLFM4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFM4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Olfactomedin 4

Target: Olfactomedin 4 (OLFM4)

Andere Bezeichnung: OLFM4

Hintergrund: OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.

Molekulargewicht: 55 kDa (MW of target protein)