Glypican 3 Antikörper (Middle Region)
-
- Target Alle Glypican 3 (GPC3) Antikörper anzeigen
- Glypican 3 (GPC3)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Glypican 3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GPC3 antibody was raised against the middle region of GPC3
- Aufreinigung
- Purified
- Immunogen
- GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
- Top Product
- Discover our top product GPC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GPC3 Blocking Peptide, catalog no. 33R-3080, is also available for use as a blocking control in assays to test for specificity of this GPC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glypican 3 (GPC3)
- Andere Bezeichnung
- GPC3 (GPC3 Produkte)
- Synonyme
- GPC3 antikoerper, sgb antikoerper, dgsx antikoerper, sdys antikoerper, sgbs antikoerper, oci-5 antikoerper, sgbs1 antikoerper, DGSX antikoerper, GTR2-2 antikoerper, MXR7 antikoerper, OCI-5 antikoerper, SDYS antikoerper, SGB antikoerper, SGBS antikoerper, SGBS1 antikoerper, Glypican-3 antikoerper, glypican 3 antikoerper, gpc3 antikoerper, GPC3 antikoerper, Gpc3 antikoerper
- Hintergrund
- Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
- Molekulargewicht
- 64 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-