Glypican 3 Antikörper (Middle Region)

Produktnummer ABIN630140

Der Kaninchen Polyklonal Anti-Glypican 3-Antikörper wurde für WB validiert. Er ist geeignet, Glypican 3 in Proben von Human, Ratte, Maus und Hund zu detektieren.

Kurzübersicht für Glypican 3 Antikörper (Middle Region) (ABIN630140)

Target: Glypican 3 (GPC3)

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Glypican 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Glypican 3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GPC3 antibody was raised against the middle region of GPC3

Aufreinigung: Purified

Immunogen: GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPC3 Blocking Peptide, (ABIN938466), is also available for use as a blocking control in assays to test for specificity of this GPC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Glypican 3

Target: Glypican 3 (GPC3)

Andere Bezeichnung: GPC3

Hintergrund: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process