SOD1 Antikörper (N-Term)

Produktnummer ABIN630121

Produktdetails anti-SOD1 Antikörper

Target: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SOD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: SOD1 antibody was raised against the N terminal of SOD1

Aufreinigung: Purified

Immunogen: SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SOD1 Blocking Peptide, catalog no. 33R-5777, is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SOD1

Target: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Andere Bezeichnung: SOD1 (SOD1 Produkte)

Synonyme: LOC692639 antikoerper, ALS antikoerper, ALS1 antikoerper, IPOA antikoerper, SOD antikoerper, hSod1 antikoerper, homodimer antikoerper, CG11793 antikoerper, Cu antikoerper, Cu-Zn SOD antikoerper, Cu/Zn SOD antikoerper, Cu/Zn sod antikoerper, Cu/Zn superoxide dismutase antikoerper, Cu/ZnSOD antikoerper, CuSOD antikoerper, CuZn SOD antikoerper, CuZn-SOD antikoerper, CuZn-SOD1 antikoerper, CuZnSOD antikoerper, Cu[2+]/Zn[2+]SOD antikoerper, Dmel\\CG11793 antikoerper, G antikoerper, Mn SOD antikoerper, SOD-1 antikoerper, SOD1 antikoerper, Sod-1 antikoerper, Sod1 antikoerper, To antikoerper, To-1 antikoerper, Zn SOD antikoerper, Zn Sod antikoerper, Zn-SOD antikoerper, ZnSod antikoerper, cSOD antikoerper, cSod antikoerper, dSOD1 antikoerper, l(3)108 antikoerper, l(3)68Af' antikoerper, l(3)G antikoerper, sod antikoerper, sod1 antikoerper, CU/ZN-SOD antikoerper, SODC antikoerper, DKFZP469M1833 antikoerper, B430204E11Rik antikoerper, Cu/Zn-SOD antikoerper, Ipo-1 antikoerper, Ipo1 antikoerper, SOD1L1 antikoerper, XSODB antikoerper, als antikoerper, als1 antikoerper, ipoa antikoerper, sod1-a antikoerper, ZSOD antikoerper, cuzn antikoerper, Cu/Zn superoxide dismutase antikoerper, superoxide dismutase 1 antikoerper, Superoxide dismutase 1 antikoerper, superoxide dismutase 1, soluble antikoerper, superoxide dismutase 1 S homeolog antikoerper, Superoxide dismutase [Cu-Zn] antikoerper, superoxide dismutase 1 L homeolog antikoerper, superoxide dismutase [Cu-Zn]-like antikoerper, superoxide dismutase [Cu-Zn] antikoerper, superoxide dismutase Sod1 antikoerper, SOD antikoerper, SOD1 antikoerper, Sod1 antikoerper, sod1 antikoerper, sod1.S antikoerper, sod-1 antikoerper, sod1.L antikoerper, LOC101451855 antikoerper, LOC101115136 antikoerper

Hintergrund: SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis