SOD1 Antikörper (N-Term)
-
- Target Alle SOD1 Antikörper anzeigen
- SOD1 (Superoxide Dismutase 1, Soluble (SOD1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SOD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- SOD1 antibody was raised against the N terminal of SOD1
- Aufreinigung
- Purified
- Immunogen
- SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
- Top Product
- Discover our top product SOD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SOD1 Blocking Peptide, catalog no. 33R-5777, is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SOD1 (Superoxide Dismutase 1, Soluble (SOD1))
- Andere Bezeichnung
- SOD1 (SOD1 Produkte)
- Hintergrund
- SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.
- Molekulargewicht
- 16 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Transition Metal Ion Homeostasis
-