SOD1 Antikörper (N-Term)

Produktnummer ABIN630121

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SOD1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für SOD1 Antikörper (N-Term) (ABIN630121)

Target: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SOD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SOD1 Antikörper

Bindungsspezifität: N-Term

Spezifität: SOD1 antibody was raised against the N terminal of SOD1

Aufreinigung: Purified

Immunogen: SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SOD1 Blocking Peptide, (ABIN5616333), is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SOD1

Target: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Andere Bezeichnung: SOD1

Hintergrund: SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.

Molekulargewicht: 16 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis