NMUR2 Antikörper (N-Term)

Produktnummer ABIN630112

Produktdetails anti-NMUR2 Antikörper

Target: NMUR2 (Neuromedin U Receptor 2 (NMUR2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NMUR2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NMUR2 antibody was raised against the N terminal of NMUR2

Aufreinigung: Purified

Immunogen: NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NMUR2 Blocking Peptide, catalog no. 33R-6432, is also available for use as a blocking control in assays to test for specificity of this NMUR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NMUR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NMUR2

Target: NMUR2 (Neuromedin U Receptor 2 (NMUR2))

Andere Bezeichnung: NMUR2 (NMUR2 Produkte)

Synonyme: NMUR2 antikoerper, NMSR2 antikoerper, FM-4 antikoerper, FM4 antikoerper, NMU-R2 antikoerper, NMU2R antikoerper, TGR-1 antikoerper, TGR1 antikoerper, Nmu2r antikoerper, neuromedin U receptor 2 antikoerper, NMUR2 antikoerper, Nmur2 antikoerper

Hintergrund: NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Feeding Behaviour