KCNK3 Antikörper (C-Term)

Produktnummer ABIN630109

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch KCNK3 in WB. Es zeigt Reaktivität gegenüber Proben von Ratte, Human, Maus und Hund.

Kurzübersicht für KCNK3 Antikörper (C-Term) (ABIN630109)

Target: KCNK3 (Potassium Channel, Subfamily K, Member 3 (KCNK3))

Reaktivität: Ratte, Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNK3 Antikörper

Bindungsspezifität: C-Term

Spezifität: KCNK3 antibody was raised against the C terminal of KCNK3

Aufreinigung: Purified

Immunogen: KCNK3 antibody was raised using the C terminal of KCNK3 corresponding to a region with amino acids TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK3 Blocking Peptide, (ABIN5614286), is also available for use as a blocking control in assays to test for specificity of this KCNK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK3

Target: KCNK3 (Potassium Channel, Subfamily K, Member 3 (KCNK3))

Andere Bezeichnung: KCNK3

Hintergrund: KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.

Molekulargewicht: 43 kDa (MW of target protein)