GABRB2 Antikörper

Produktnummer ABIN630104

Der Kaninchen Polyklonal Anti-GABRB2-Antikörper wurde für WB validiert. Er ist geeignet, GABRB2 in Proben von Human, Ratte, Maus und Hund zu detektieren.

Kurzübersicht für GABRB2 Antikörper (ABIN630104)

Target: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABRB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GABRB2 Antikörper

Aufreinigung: Purified

Immunogen: GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABRB2 Blocking Peptide, (ABIN5613694), is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABRB2

Target: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Andere Bezeichnung: GABRB2

Hintergrund: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Synaptic Membrane