CLIC5 Antikörper (Middle Region)

Produktnummer ABIN630088

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch CLIC5 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für CLIC5 Antikörper (Middle Region) (ABIN630088)

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLIC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CLIC5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: CLIC5 antibody was raised against the middle region of CLIC5

Aufreinigung: Purified

Immunogen: CLIC5 antibody was raised using the middle region of CLIC5 corresponding to a region with amino acids HPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLIC5 Blocking Peptide, (ABIN939201), is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLIC5

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Andere Bezeichnung: CLIC5

Hintergrund: CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli. CLIon Channel-5A has a role as a chloride channel in vitro and binds to cortical actin cytoskeleton.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Sensory Perception of Sound