ACCN5 Antikörper (Middle Region)

Produktnummer ABIN630083

Produktdetails anti-ACCN5 Antikörper

Target: ACCN5 (Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACCN5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACCN5 antibody was raised against the middle region of ACCN5

Aufreinigung: Purified

Immunogen: ACCN5 antibody was raised using the middle region of ACCN5 corresponding to a region with amino acids FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACCN5 Blocking Peptide, catalog no. 33R-3090, is also available for use as a blocking control in assays to test for specificity of this ACCN5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACCN5

Target: ACCN5 (Amiloride-Sensitive Cation Channel 5, Intestinal (ACCN5))

Andere Bezeichnung: ACCN5 (ACCN5 Produkte)

Synonyme: ACCN5 antikoerper, HINAC antikoerper, INAC antikoerper, Accn5 antikoerper, Blinac antikoerper, Inac antikoerper, acid sensing ion channel subunit family member 5 antikoerper, acid-sensing (proton-gated) ion channel family member 5 antikoerper, ASIC5 antikoerper, asic5 antikoerper, Asic5 antikoerper

Hintergrund: ACCN5 belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known.

Molekulargewicht: 56 kDa (MW of target protein)