CLIC5 Antikörper (C-Term)

Produktnummer ABIN630075

Dieses Anti-CLIC5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CLIC5 in WB und IHC. Geeignet für Human.

Kurzübersicht für CLIC5 Antikörper (C-Term) (ABIN630075)

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLIC5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-CLIC5 Antikörper

Bindungsspezifität: C-Term

Spezifität: CLIC5 antibody was raised against the C terminal of CLIC5

Aufreinigung: Purified

Immunogen: CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLIC5 Blocking Peptide, (ABIN936202), is also available for use as a blocking control in assays to test for specificity of this CLIC5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLIC5

Target: CLIC5 (Chloride Intracellular Channel 5 (CLIC5))

Andere Bezeichnung: CLIC5

Hintergrund: Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Sensory Perception of Sound