DDX17 Antikörper
-
- Target Alle DDX17 Antikörper anzeigen
- DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX17 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- DDX17 antibody was raised using a synthetic peptide corresponding to a region with amino acids TSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGY
- Top Product
- Discover our top product DDX17 Primärantikörper
-
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) antibody
DDX17 Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (AA 128-155), (N-Term) antibodyDDX17 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB23482 unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibodyDDX17 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Rind (Kuh), Pferd, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (AA 570-619) antibodyDDX17 Reaktivität: Human, Hund, Meerschweinchen, Fledermaus, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) antibodyDDX17 Reaktivität: Human WB, ICC, DB Wirt: Maus Monoclonal 2248C2a unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (AA 55-85), (N-Term) antibodyDDX17 Reaktivität: Human WB, FACS, IHC (p), EIA Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (AA 591-692) antibodyDDX17 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) antibodyDDX17 Reaktivität: Human, Maus FACS Wirt: Maus Monoclonal 1B5B09 unconjugated
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17) (N-Term) antibodyDDX17 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Rind (Kuh), Pferd, Kaninchen, Saccharomyces cerevisiae WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX17 Blocking Peptide, catalog no. 33R-9297, is also available for use as a blocking control in assays to test for specificity of this DDX17 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX17 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX17 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 17 (DDX17))
- Andere Bezeichnung
- DDX17 (DDX17 Produkte)
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.
- Molekulargewicht
- 60 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Regulation of Muscle Cell Differentiation
-
