Seryl-tRNA Synthetase (SARS) (Middle Region) Antikörper
-
- Target Alle Seryl-tRNA Synthetase (SARS) Antikörper anzeigen
- Seryl-tRNA Synthetase (SARS)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SARS antibody was raised against the middle region of SARS
- Aufreinigung
- Purified
- Immunogen
- SARS antibody was raised using the middle region of SARS corresponding to a region with amino acids SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL
- Top Product
- Discover our top product SARS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SARS Blocking Peptide, catalog no. 33R-8713, is also available for use as a blocking control in assays to test for specificity of this SARS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Seryl-tRNA Synthetase (SARS)
- Andere Bezeichnung
- SARS (SARS Produkte)
- Synonyme
- SERRS antikoerper, SERS antikoerper, Sars1 antikoerper, Strs antikoerper, serRS antikoerper, SerRS antikoerper, wu:fk51f08 antikoerper, zgc:92152 antikoerper, seryl-tRNA synthetase antikoerper, seryl-aminoacyl-tRNA synthetase antikoerper, SARS antikoerper, Sars antikoerper, sars antikoerper
- Hintergrund
- SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.
- Molekulargewicht
- 57 kDa (MW of target protein)
-