Seryl-tRNA Synthetase (SARS) (C-Term) Antikörper

Produktnummer ABIN630017

Produktdetails

Target: Seryl-tRNA Synthetase (SARS)

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SARS antibody was raised against the C terminal of SARS

Aufreinigung: Purified

Immunogen: SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SARS Blocking Peptide, catalog no. 33R-7048, is also available for use as a blocking control in assays to test for specificity of this SARS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SARS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Seryl-tRNA Synthetase (SARS)

Andere Bezeichnung: SARS (SARS Produkte)

Synonyme: SERRS antikoerper, SERS antikoerper, Sars1 antikoerper, Strs antikoerper, serRS antikoerper, SerRS antikoerper, wu:fk51f08 antikoerper, zgc:92152 antikoerper, seryl-tRNA synthetase antikoerper, seryl-aminoacyl-tRNA synthetase antikoerper, SARS antikoerper, Sars antikoerper, sars antikoerper

Hintergrund: SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Molekulargewicht: 57 kDa (MW of target protein)