RPLP0 Antikörper (Middle Region)

Produktnummer ABIN630015

Dieses Anti-RPLP0-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RPLP0 in WB. Geeignet für Human und Hund.

Kurzübersicht für RPLP0 Antikörper (Middle Region) (ABIN630015)

Target: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPLP0 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPLP0 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPLP0 antibody was raised against the middle region of RPLP0

Aufreinigung: Purified

Immunogen: RPLP0 antibody was raised using the middle region of RPLP0 corresponding to a region with amino acids PFSFGLVIQQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGY

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPLP0 Blocking Peptide, (ABIN5615942), is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPLP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPLP0

Target: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Andere Bezeichnung: RPLP0

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2.

Molekulargewicht: 35 kDa (MW of target protein)