TRA2B Antikörper

Produktnummer ABIN629994

Dieses Anti-TRA2B-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TRA2B in WB und IHC. Geeignet für Human, Maus, Hund und Ratte.

Kurzübersicht für TRA2B Antikörper (ABIN629994)

Target: TRA2B (Transformer 2 beta Homolog (TRA2B))

Reaktivität: Human, Maus, Hund, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRA2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-TRA2B Antikörper

Aufreinigung: Purified

Immunogen: SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS10 Blocking Peptide, (ABIN939022), is also available for use as a blocking control in assays to test for specificity of this SFRS10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRA2B

Target: TRA2B (Transformer 2 beta Homolog (TRA2B))

Andere Bezeichnung: SFRS10

Hintergrund: SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.

Molekulargewicht: 32 kDa (MW of target protein)