TRA2B Antikörper
-
- Target Alle TRA2B Antikörper anzeigen
- TRA2B (Transformer 2 beta Homolog (TRA2B))
-
Reaktivität
- Human, Maus, Hund, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRA2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Aufreinigung
- Purified
- Immunogen
- SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD
- Top Product
- Discover our top product TRA2B Primärantikörper
-
anti-Transformer 2 beta Homolog (TRA2B) (AA 120-199) antibody
TRA2B Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 7A1 unconjugated
anti-Transformer 2 beta Homolog (TRA2B) (N-Term) antibodyTRA2B Reaktivität: Human, Maus, Hund, Ratte, Rind (Kuh), Pferd, Kaninchen, Schwein WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Transformer 2 beta Homolog (TRA2B) antibodyTRA2B Reaktivität: Human, Maus, Hund, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Transformer 2 beta Homolog (TRA2B) (AA 121-170) antibodyTRA2B Reaktivität: Human, Maus, Hund, Ratte, Rind (Kuh), Pferd, Kaninchen, Schwein, Meerschweinchen, Huhn, Hamster, Affe, Fledermaus, Xenopus laevis WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Transformer 2 beta Homolog (TRA2B) (N-Term) antibodyTRA2B Reaktivität: Human, Maus, Hund, Ratte, Rind (Kuh), Pferd, Kaninchen, Schwein, Huhn, Hamster, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Transformer 2 beta Homolog (TRA2B) (Middle Region) antibodyTRA2B Reaktivität: Human, Maus, Hund, Ratte, Rind (Kuh), Pferd, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Transformer 2 beta Homolog (TRA2B) (AA 120-199) antibodyTRA2B Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Transformer 2 beta Homolog (TRA2B) (AA 64-204) antibodyTRA2B Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Transformer 2 beta Homolog (TRA2B) (AA 208-237) antibodyTRA2B Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRS10 Blocking Peptide, catalog no. 33R-3636, is also available for use as a blocking control in assays to test for specificity of this SFRS10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRA2B (Transformer 2 beta Homolog (TRA2B))
- Andere Bezeichnung
- SFRS10 (TRA2B Produkte)
- Hintergrund
- SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
- Molekulargewicht
- 32 kDa (MW of target protein)
-
