EIF2S1 Antikörper (C-Term)

Produktnummer ABIN629992

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch EIF2S1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für EIF2S1 Antikörper (C-Term) (ABIN629992)

Target: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF2S1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-EIF2S1 Antikörper

Bindungsspezifität: C-Term

Spezifität: EIF2 S1 antibody was raised against the C terminal of EIF2 1

Aufreinigung: Purified

Immunogen: EIF2 S1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF2S1 Blocking Peptide, (ABIN5613326), is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF2S1

Target: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Andere Bezeichnung: EIF2S1

Hintergrund: The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is composed of 3 nonidentical subunits, alpha (36 kDa), beta (38 kDa), and gamma (52 kDa). The rate of formation of the ternary complex is modulated by the phosphorylation state of eIF2-alpha.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, ER-Nucleus Signaling, Hepatitis C