PTBP2 Antikörper (N-Term)

Produktnummer ABIN629977

Produktdetails anti-PTBP2 Antikörper

Target: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTBP2 antibody was raised against the N terminal of PTBP2

Aufreinigung: Purified

Immunogen: PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTBP2 Blocking Peptide, catalog no. 33R-5835, is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTBP2

Target: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Andere Bezeichnung: PTBP2 (PTBP2 Produkte)

Synonyme: PTB antikoerper, PTBLP antikoerper, brPTB antikoerper, nPTB antikoerper, nPTB5 antikoerper, nPTB6 antikoerper, nPTB7 antikoerper, nPTB8 antikoerper, Ptb2 antikoerper, PTBP2 antikoerper, im:7153495 antikoerper, ptbp2 antikoerper, si:ch211-160l17.2 antikoerper, wu:fa08f05 antikoerper, wu:fc05d10 antikoerper, zgc:113074 antikoerper, polypyrimidine tract binding protein 2 antikoerper, polypyrimidine tract binding protein 2b antikoerper, polypyrimidine tract binding protein 2a antikoerper, PTBP2 antikoerper, Ptbp2 antikoerper, ptbp2b antikoerper, ptbp2a antikoerper

Hintergrund: PTBP2 binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interaktom