MSI2 Antikörper

Produktnummer ABIN629967

Dieser Anti-MSI2-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von MSI2 in WB und IHC. Geeignet für Human, Maus, Ratte, Zebrafisch (Danio rerio) und C. elegans.

Kurzübersicht für MSI2 Antikörper (ABIN629967)

Target: MSI2 (Musashi Homolog 2 (MSI2))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSI2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-MSI2 Antikörper

Aufreinigung: Purified

Immunogen: MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MSI2 Blocking Peptide, (ABIN5614853), is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSI2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MSI2

Target: MSI2 (Musashi Homolog 2 (MSI2))

Andere Bezeichnung: MSI2

Hintergrund: MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.

Molekulargewicht: 36 kDa (MW of target protein)