SRSF1 Antikörper

Produktnummer ABIN629883

Produktdetails anti-SRSF1 Antikörper

Target: SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRSF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS1 Blocking Peptide, catalog no. 33R-3658, is also available for use as a blocking control in assays to test for specificity of this SFRS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRSF1

Target: SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))

Andere Bezeichnung: SFRS1 (SRSF1 Produkte)

Hintergrund: SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization