BRK1 Antikörper (Middle Region)
-
- Target Alle BRK1 Antikörper anzeigen
- BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BRK1 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- C3 ORF10 antibody was raised against the middle region of C3 rf10
- Aufreinigung
- Purified
- Immunogen
- C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
- Top Product
- Discover our top product BRK1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))
- Andere Bezeichnung
- C3ORF10 (BRK1 Produkte)
- Synonyme
- brk1 antikoerper, C22H3orf10 antikoerper, brick1 antikoerper, c3orf10 antikoerper, C3orf10 antikoerper, MDS027 antikoerper, hHBrk1 antikoerper, 6720456B07Rik antikoerper, AW011779 antikoerper, ATBRK1 antikoerper, BRICK1 antikoerper, HSPC300 antikoerper, T9I22.8 antikoerper, T9I22_8 antikoerper, BRICK1, SCAR/WAVE actin-nucleating complex subunit antikoerper, BRICK1, SCAR/WAVE actin nucleating complex subunit antikoerper, brick 1 antikoerper, BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog antikoerper, BRICK1 antikoerper, brk1 antikoerper, BRK1 antikoerper, Brk1 antikoerper, brk1.S antikoerper
- Hintergrund
- C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
- Molekulargewicht
- 9 kDa (MW of target protein)
- Pathways
- RTK Signalweg
-