BRK1 Antikörper (Middle Region)

Produktnummer ABIN629872

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch BRK1 in IHC und WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für BRK1 Antikörper (Middle Region) (ABIN629872)

Target: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BRK1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-BRK1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C3 ORF10 antibody was raised against the middle region of C3 rf10

Aufreinigung: Purified

Immunogen: C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C3ORF10 Blocking Peptide, (ABIN936099), is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BRK1

Target: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Andere Bezeichnung: C3ORF10

Hintergrund: C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.

Molekulargewicht: 9 kDa (MW of target protein)

Pathways: RTK Signalweg