BRK1 Antikörper (Middle Region)

Produktnummer ABIN629872

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch BRK1 in IHC und WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für BRK1 Antikörper (Middle Region) (ABIN629872)

Target: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BRK1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails anti-BRK1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: C3 ORF10 antibody was raised against the middle region of C3 rf10

Aufreinigung: Purified

Immunogen: C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C3ORF10 Blocking Peptide, (ABIN936099), is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BRK1

Target: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Andere Bezeichnung: C3ORF10

Hintergrund: C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.

Molekulargewicht: 9 kDa (MW of target protein)

Pathways: RTK Signalweg