PLIN1 Antikörper (N-Term)

Produktnummer ABIN629870

Der Kaninchen Polyklonal Anti-PLIN1-Antikörper wurde für WB validiert. Er ist geeignet, PLIN1 in Proben von Human, Maus, Ratte und Hund zu detektieren. Es ist 1 Publikation verfügbar.

Kurzübersicht für PLIN1 Antikörper (N-Term) (ABIN629870)

Target: PLIN1 (Perilipin 1 (PLIN1))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLIN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLIN1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Perilipin antibody was raised against the N terminal of PLIN

Aufreinigung: Purified

Immunogen: Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Perilipin Blocking Peptide, (ABIN5615312), is also available for use as a blocking control in assays to test for specificity of this Perilipin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLIN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-PLIN1 Antikörper (ABIN629870)

Rudolph, Jackman, Presby, Houck, Webb, Johnson, Soderborg, de la Houssaye, Yang, Friedman, MacLean: "Low Neonatal Plasma n-6/n-3 PUFA Ratios Regulate Offspring Adipogenic Potential and Condition Adult Obesity Resistance." in: Diabetes, Vol. 67, Issue 4, pp. 651-661, (2018) (PubMed).

Details zu PLIN1

Target: PLIN1 (Perilipin 1 (PLIN1))

Andere Bezeichnung: Perilipin

Hintergrund: PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Lipid Metabolism