Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) Antikörper

Produktnummer ABIN629855

Der Kaninchen Polyklonal Anti--Antikörper wurde für WB validiert. Er ist geeignet, in Proben von Human, Maus, Ratte und Hund zu detektieren.

Kurzübersicht für Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) Antikörper (ABIN629855)

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: C6 ORF134 antibody was raised against the N terminal Of C6 rf134

Aufreinigung: Purified

Immunogen: C6 ORF134 antibody was raised using the N terminal Of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6ORF134 Blocking Peptide, (ABIN5612529), is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF134 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Andere Bezeichnung: C6ORF134

Hintergrund: The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 36 kDa (MW of target protein)