PSG3 Antikörper (N-Term)

Produktnummer ABIN629852

Produktdetails anti-PSG3 Antikörper

Target: PSG3 (Pregnancy Specific beta-1-Glycoprotein 3 (PSG3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSG3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PSG3 antibody was raised against the N terminal of PSG3

Aufreinigung: Purified

Immunogen: PSG3 antibody was raised using the N terminal of PSG3 corresponding to a region with amino acids VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSG3 Blocking Peptide, catalog no. 33R-9927, is also available for use as a blocking control in assays to test for specificity of this PSG3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSG3

Target: PSG3 (Pregnancy Specific beta-1-Glycoprotein 3 (PSG3))

Andere Bezeichnung: PSG3 (PSG3 Produkte)

Synonyme: PSG3 antikoerper, pregnancy specific beta-1-glycoprotein 3 antikoerper, pregnancy-specific beta-1-glycoprotein 3 antikoerper, PSG3 antikoerper, LOC741127 antikoerper

Hintergrund: The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes.

Molekulargewicht: 16 kDa (MW of target protein)