ACP1 Antikörper (N-Term)

Produktnummer ABIN629849

Produktdetails anti-ACP1 Antikörper

Target: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ACP1 antibody was raised against the N terminal of ACP1

Aufreinigung: Purified

Immunogen: ACP1 antibody was raised using the N terminal of ACP1 corresponding to a region with amino acids PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACP1 Blocking Peptide, catalog no. 33R-7150, is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACP1

Target: ACP1 (Acid Phosphatase 1, Soluble (ACP1))

Andere Bezeichnung: ACP1 (ACP1 Produkte)

Synonyme: HAAP antikoerper, 4632432E04Rik antikoerper, AI427468 antikoerper, Acp-1 antikoerper, LMW-PTP antikoerper, haap antikoerper, lmw-ptp antikoerper, ptp1a antikoerper, xlptp1 antikoerper, im:6910498 antikoerper, zgc:110844 antikoerper, Acp1 antikoerper, ACYPI006806 antikoerper, ACP antikoerper, ACPH antikoerper, APH antikoerper, Acph antikoerper, CG7899 antikoerper, Dmel\\CG7899 antikoerper, DDBDRAFT_0189318 antikoerper, DDBDRAFT_0266663 antikoerper, DDB_0189318 antikoerper, DDB_0266663 antikoerper, ACP1 antikoerper, XLPTP1 antikoerper, acp1 antikoerper, acp1a antikoerper, ptp1a-A antikoerper, LMW-PTPase antikoerper, acid phosphatase 1 antikoerper, acid phosphatase 1, soluble antikoerper, Acid phosphatase 1 antikoerper, acid phosphatase 1 L homeolog antikoerper, ACP1 antikoerper, Acp1 antikoerper, acp1 antikoerper, Acph-1 antikoerper, acp1.L antikoerper

Hintergrund: ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate.

Molekulargewicht: 17 kDa (MW of target protein)