ADH1B Antikörper

Produktnummer ABIN629844

Dieser Anti-ADH1B-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von ADH1B in WB und IHC. Geeignet für Human.

Kurzübersicht für ADH1B Antikörper (ABIN629844)

Target: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADH1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ADH1B Antikörper

Aufreinigung: Purified

Immunogen: ADH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADH1B Blocking Peptide, (ABIN5611948), is also available for use as a blocking control in assays to test for specificity of this ADH1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADH1B

Target: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Andere Bezeichnung: ADH1B

Hintergrund: ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Molekulargewicht: 41 kDa (MW of target protein)