TPM2 Antikörper

Produktnummer ABIN629837

Der Kaninchen Polyklonal anti-TPM2 Antikörper wird verwendet zum Nachweis von TPM2 in Proben von Human und Maus. Er wurde validiert für WB und IHC.

Kurzübersicht für TPM2 Antikörper (ABIN629837)

Target: TPM2 (Tropomyosin-2 (TPM2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-TPM2 Antikörper

Aufreinigung: Purified

Immunogen: Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tropomyosin 2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPM2

Target: TPM2 (Tropomyosin-2 (TPM2))

Andere Bezeichnung: Tropomyosin 2

Hintergrund: The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.

Molekulargewicht: 33 kDa (MW of target protein)