TPM2 Antikörper

Produktnummer ABIN629837

Produktdetails anti-TPM2 Antikörper

Target: TPM2 (Tropomyosin-2 (TPM2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TPM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tropomyosin 2 Blocking Peptide, catalog no. 33R-1152, is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TPM2

Target: TPM2 (Tropomyosin-2 (TPM2))

Andere Bezeichnung: Tropomyosin 2 (TPM2 Produkte)

Synonyme: CG4843 antikoerper, DROTROPI1 antikoerper, Dmel\\CG4843 antikoerper, Ifm(3)3 antikoerper, Ifm(3)5 antikoerper, Ifm-TmI antikoerper, TM2 antikoerper, Tm antikoerper, Tm1 antikoerper, Tm127 antikoerper, TmI antikoerper, TmII antikoerper, Tn-H antikoerper, dro Tm antikoerper, l(3)nc99Eb antikoerper, mTmI antikoerper, cb836 antikoerper, fb68h02 antikoerper, tpm4l antikoerper, wu:fb68h02 antikoerper, wu:fj63f03 antikoerper, zgc:86810 antikoerper, AMCD1 antikoerper, DA1 antikoerper, DA2B antikoerper, TMSB antikoerper, nem4 antikoerper, tpm2 antikoerper, tpm2a antikoerper, BRT-2 antikoerper, TPM3 antikoerper, NEM4 antikoerper, Tpm-2 antikoerper, Trop-2 antikoerper, Tropomyosin 2 antikoerper, Tropomyosin-2 antikoerper, tropomyosin antikoerper, tropomyosin 2 (beta) antikoerper, tropomyosin 2 L homeolog antikoerper, tropomyosin 2 antikoerper, tropomyosin 2, beta antikoerper, Tm2 antikoerper, EDI_309330 antikoerper, LOC100101174 antikoerper, tpm2 antikoerper, tpm2.L antikoerper, TPM2 antikoerper, Tpm2 antikoerper

Hintergrund: The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.

Molekulargewicht: 33 kDa (MW of target protein)